Anti NSL1 pAb (ATL-HPA045761 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045761-25

• 

Protein Description: NSL1, MIS12 kinetochore complex component
Gene Name: NSL1
Alternative Gene Name: C1orf48, DC8, DKFZP566O1646, MIS14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062510: 76%, ENSRNOG00000042286: 79%
Entrez Gene ID: 25936
Uniprot ID: Q96IY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYP
• Gene Sequence: FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYP
• Gene ID - Mouse: ENSMUSG00000062510
• Gene ID - Rat: ENSRNOG00000042286
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.