Anti NSFL1C pAb (ATL-HPA050628 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050628-25

• 
• 
• 

Protein Description: NSFL1 (p97) cofactor (p47)
Gene Name: NSFL1C
Alternative Gene Name: dJ776F14.1, p47, UBX1, UBXD10, UBXN2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027455: 100%, ENSRNOG00000008604: 100%
Entrez Gene ID: 55968
Uniprot ID: Q9UNZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG
• Gene Sequence: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG
• Gene ID - Mouse: ENSMUSG00000027455
• Gene ID - Rat: ENSRNOG00000008604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.