Protein Description: N-ethylmaleimide-sensitive factor
Gene Name: NSF
Alternative Gene Name: SKD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034187: 100%, ENSRNOG00000003905: 100%
Entrez Gene ID: 4905
Uniprot ID: P46459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NSF
Alternative Gene Name: SKD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034187: 100%, ENSRNOG00000003905: 100%
Entrez Gene ID: 4905
Uniprot ID: P46459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMG |
| Documents & Links for Anti NSF pAb (ATL-HPA071089) | |
| Datasheet | Anti NSF pAb (ATL-HPA071089) Datasheet (External Link) |
| Vendor Page | Anti NSF pAb (ATL-HPA071089) at Atlas |
| Documents & Links for Anti NSF pAb (ATL-HPA071089) | |
| Datasheet | Anti NSF pAb (ATL-HPA071089) Datasheet (External Link) |
| Vendor Page | Anti NSF pAb (ATL-HPA071089) |