Protein Description: nuclear receptor binding SET domain protein 1
Gene Name: NSD1
Alternative Gene Name: ARA267, FLJ22263, KMT3B, STO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021488: 63%, ENSRNOG00000016680: 67%
Entrez Gene ID: 64324
Uniprot ID: Q96L73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NSD1
Alternative Gene Name: ARA267, FLJ22263, KMT3B, STO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021488: 63%, ENSRNOG00000016680: 67%
Entrez Gene ID: 64324
Uniprot ID: Q96L73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETSQVNLSDLKASTLVHKPQSDFT |
| Documents & Links for Anti NSD1 pAb (ATL-HPA073705) | |
| Datasheet | Anti NSD1 pAb (ATL-HPA073705) Datasheet (External Link) |
| Vendor Page | Anti NSD1 pAb (ATL-HPA073705) at Atlas |
| Documents & Links for Anti NSD1 pAb (ATL-HPA073705) | |
| Datasheet | Anti NSD1 pAb (ATL-HPA073705) Datasheet (External Link) |
| Vendor Page | Anti NSD1 pAb (ATL-HPA073705) |