Anti NSD1 pAb (ATL-HPA048431)

Atlas Antibodies

SKU:
ATL-HPA048431-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nuclear receptor binding SET domain protein 1
Gene Name: NSD1
Alternative Gene Name: ARA267, FLJ22263, KMT3B, STO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021488: 91%, ENSRNOG00000016680: 90%
Entrez Gene ID: 64324
Uniprot ID: Q96L73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSY
Gene Sequence INEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSY
Gene ID - Mouse ENSMUSG00000021488
Gene ID - Rat ENSRNOG00000016680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NSD1 pAb (ATL-HPA048431)
Datasheet Anti NSD1 pAb (ATL-HPA048431) Datasheet (External Link)
Vendor Page Anti NSD1 pAb (ATL-HPA048431) at Atlas Antibodies

Documents & Links for Anti NSD1 pAb (ATL-HPA048431)
Datasheet Anti NSD1 pAb (ATL-HPA048431) Datasheet (External Link)
Vendor Page Anti NSD1 pAb (ATL-HPA048431)