Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054974-25

• 
• 

Protein Description: neuropilin 2
Gene Name: NRP2
Alternative Gene Name: VEGF165R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025969: 85%, ENSRNOG00000031232: 83%
Entrez Gene ID: 8828
Uniprot ID: O60462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY
• Gene Sequence: PSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY
• Gene ID - Mouse: ENSMUSG00000025969
• Gene ID - Rat: ENSRNOG00000031232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NRP2 pAb (ATL-HPA054974 w/enhanced validation) – 1 Found

Plant, Tracie; Eamsamarng, Suttida; Sanchez-Garcia, Manuel A; Reyes, Leila; Renshaw, Stephen A; Coelho, Patricia; Mirchandani, Ananda S; Morgan, Jessie-May; Ellett, Felix E; Morrison, Tyler; Humphries, Duncan; Watts, Emily R; Murphy, Fiona; Raffo-Iraolagoitia, Ximena L; Zhang, Ailiang; Cash, Jenna L; Loynes, Catherine; Elks, Philip M; Van Eeden, Freek; Carlin, Leo M; Furley, Andrew Jw; Whyte, Moira Kb; Walmsley, Sarah R. Semaphorin 3F signaling actively retains neutrophils at sites of inflammation. The Journal Of Clinical Investigation. 2020;130(6):3221-3237.