Anti NRIP1 pAb (ATL-HPA060036)

Atlas Antibodies

SKU: ATL-HPA060036-25

• 

Product Description

Protein Description: nuclear receptor interacting protein 1
Gene Name: NRIP1
Alternative Gene Name: RIP140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048490: 84%, ENSRNOG00000001585: 84%
Entrez Gene ID: 8204
Uniprot ID: P48552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLLNGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPIL
• Gene Sequence: SKPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLLNGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPIL
• Gene ID - Mouse: ENSMUSG00000048490
• Gene ID - Rat: ENSRNOG00000001585
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links