Anti NRIP1 pAb (ATL-HPA046571)

Atlas Antibodies

SKU:
ATL-HPA046571-25
  • Immunohistochemical staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear receptor interacting protein 1
Gene Name: NRIP1
Alternative Gene Name: RIP140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048490: 79%, ENSRNOG00000001585: 80%
Entrez Gene ID: 8204
Uniprot ID: P48552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ
Gene Sequence SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ
Gene ID - Mouse ENSMUSG00000048490
Gene ID - Rat ENSRNOG00000001585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NRIP1 pAb (ATL-HPA046571)
Datasheet Anti NRIP1 pAb (ATL-HPA046571) Datasheet (External Link)
Vendor Page Anti NRIP1 pAb (ATL-HPA046571) at Atlas Antibodies

Documents & Links for Anti NRIP1 pAb (ATL-HPA046571)
Datasheet Anti NRIP1 pAb (ATL-HPA046571) Datasheet (External Link)
Vendor Page Anti NRIP1 pAb (ATL-HPA046571)



Citations for Anti NRIP1 pAb (ATL-HPA046571) – 1 Found
Sixou, Sophie; Müller, Katharina; Jalaguier, Stéphan; Kuhn, Christina; Harbeck, Nadia; Mayr, Doris; Engel, Jutta; Jeschke, Udo; Ditsch, Nina; Cavaillès, Vincent. Importance of RIP140 and LCoR Sub-Cellular Localization for Their Association With Breast Cancer Aggressiveness and Patient Survival. Translational Oncology. 2018;11(5):1090-1096.  PubMed