Anti NRDE2 pAb (ATL-HPA050583)

Atlas Antibodies

SKU: ATL-HPA050583-25

• 
• 

Protein Description: NRDE-2, necessary for RNA interference, domain containing
Gene Name: NRDE2
Alternative Gene Name: C14orf102, FLJ14051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021179: 90%, ENSRNOG00000004004: 89%
Entrez Gene ID: 55051
Uniprot ID: Q9H7Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNNTALWQKYLLFCQSQFSTFSISKIHSLYGKCLSTLSAVKDGSILSHPALPGTEEAMFALFLQQCHFLRQAGHSEKAISLFQAMVDFTFFKPDSVKDLPTKGQVEFFEPFWDSGEPRAGEKGARGWKAWMHQQERGGWV
• Gene Sequence: PNNTALWQKYLLFCQSQFSTFSISKIHSLYGKCLSTLSAVKDGSILSHPALPGTEEAMFALFLQQCHFLRQAGHSEKAISLFQAMVDFTFFKPDSVKDLPTKGQVEFFEPFWDSGEPRAGEKGARGWKAWMHQQERGGWV
• Gene ID - Mouse: ENSMUSG00000021179
• Gene ID - Rat: ENSRNOG00000004004
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.