Anti NR5A1 pAb (ATL-HPA079181)

Catalog No:
ATL-HPA079181-25
$395.00
Protein Description: nuclear receptor subfamily 5 group A member 1
Gene Name: NR5A1
Alternative Gene Name: AD4BP, ELP, FTZ1, FTZF1, hSF-1, SF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026751: 88%, ENSRNOG00000012682: 90%
Entrez Gene ID: 2516
Uniprot ID: Q13285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT
Gene ID - Mouse ENSMUSG00000026751
Gene ID - Rat ENSMUSG00000026751
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti NR5A1 pAb (ATL-HPA079181)
Datasheet Anti NR5A1 pAb (ATL-HPA079181) Datasheet (External Link)
Vendor Page Anti NR5A1 pAb (ATL-HPA079181) at Atlas

Documents & Links for Anti NR5A1 pAb (ATL-HPA079181)
Datasheet Anti NR5A1 pAb (ATL-HPA079181) Datasheet (External Link)
Vendor Page Anti NR5A1 pAb (ATL-HPA079181)