Protein Description: nuclear receptor subfamily 5 group A member 1
Gene Name: NR5A1
Alternative Gene Name: AD4BP, ELP, FTZ1, FTZF1, hSF-1, SF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026751: 88%, ENSRNOG00000012682: 90%
Entrez Gene ID: 2516
Uniprot ID: Q13285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NR5A1
Alternative Gene Name: AD4BP, ELP, FTZ1, FTZF1, hSF-1, SF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026751: 88%, ENSRNOG00000012682: 90%
Entrez Gene ID: 2516
Uniprot ID: Q13285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT |
| Documents & Links for Anti NR5A1 pAb (ATL-HPA079181) | |
| Datasheet | Anti NR5A1 pAb (ATL-HPA079181) Datasheet (External Link) |
| Vendor Page | Anti NR5A1 pAb (ATL-HPA079181) at Atlas |
| Documents & Links for Anti NR5A1 pAb (ATL-HPA079181) | |
| Datasheet | Anti NR5A1 pAb (ATL-HPA079181) Datasheet (External Link) |
| Vendor Page | Anti NR5A1 pAb (ATL-HPA079181) |