Anti NR2C2AP pAb (ATL-HPA055653)

Atlas Antibodies

SKU:
ATL-HPA055653-100
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: nuclear receptor 2C2-associated protein
Gene Name: NR2C2AP
Alternative Gene Name: TRA16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071078: 86%, ENSRNOG00000022247: 86%
Entrez Gene ID: 126382
Uniprot ID: Q86WQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGF
Gene Sequence MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGF
Gene ID - Mouse ENSMUSG00000071078
Gene ID - Rat ENSRNOG00000022247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NR2C2AP pAb (ATL-HPA055653)
Datasheet Anti NR2C2AP pAb (ATL-HPA055653) Datasheet (External Link)
Vendor Page Anti NR2C2AP pAb (ATL-HPA055653) at Atlas Antibodies

Documents & Links for Anti NR2C2AP pAb (ATL-HPA055653)
Datasheet Anti NR2C2AP pAb (ATL-HPA055653) Datasheet (External Link)
Vendor Page Anti NR2C2AP pAb (ATL-HPA055653)