Anti NR1I2 pAb (ATL-HPA055121)

Atlas Antibodies

SKU: ATL-HPA055121-25

• 

Protein Description: nuclear receptor subfamily 1, group I, member 2
Gene Name: NR1I2
Alternative Gene Name: BXR, ONR1, PAR2, PXR, SXR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023345: 26%, ENSRNOG00000007916: 31%
Entrez Gene ID: 8856
Uniprot ID: O75469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE
• Gene Sequence: RTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADE
• Gene ID - Mouse: ENSMUSG00000023345
• Gene ID - Rat: ENSRNOG00000007916
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.