Protein Description: nuclear receptor subfamily 0 group B member 1
Gene Name: NR0B1
Alternative Gene Name: AHC, AHCH, DAX1, DSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025056: 79%, ENSRNOG00000003765: 80%
Entrez Gene ID: 190
Uniprot ID: P51843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NR0B1
Alternative Gene Name: AHC, AHCH, DAX1, DSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025056: 79%, ENSRNOG00000003765: 80%
Entrez Gene ID: 190
Uniprot ID: P51843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT |
Documents & Links for Anti NR0B1 pAb (ATL-HPA067207) | |
Datasheet | Anti NR0B1 pAb (ATL-HPA067207) Datasheet (External Link) |
Vendor Page | Anti NR0B1 pAb (ATL-HPA067207) at Atlas |
Documents & Links for Anti NR0B1 pAb (ATL-HPA067207) | |
Datasheet | Anti NR0B1 pAb (ATL-HPA067207) Datasheet (External Link) |
Vendor Page | Anti NR0B1 pAb (ATL-HPA067207) |