Anti NPW pAb (ATL-HPA064874)
Atlas Antibodies
- SKU:
- ATL-HPA064874-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NPW
Alternative Gene Name: PPL8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071230: 37%, ENSRNOG00000012390: 41%
Entrez Gene ID: 283869
Uniprot ID: Q8N729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR |
Gene Sequence | REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR |
Gene ID - Mouse | ENSMUSG00000071230 |
Gene ID - Rat | ENSRNOG00000012390 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NPW pAb (ATL-HPA064874) | |
Datasheet | Anti NPW pAb (ATL-HPA064874) Datasheet (External Link) |
Vendor Page | Anti NPW pAb (ATL-HPA064874) at Atlas Antibodies |
Documents & Links for Anti NPW pAb (ATL-HPA064874) | |
Datasheet | Anti NPW pAb (ATL-HPA064874) Datasheet (External Link) |
Vendor Page | Anti NPW pAb (ATL-HPA064874) |