Anti NPTX2 pAb (ATL-HPA049799)
Atlas Antibodies
- SKU:
- ATL-HPA049799-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NPTX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059991: 98%, ENSRNOG00000001006: 98%
Entrez Gene ID: 4885
Uniprot ID: P47972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLLDL |
| Gene Sequence | LSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLLDL |
| Gene ID - Mouse | ENSMUSG00000059991 |
| Gene ID - Rat | ENSRNOG00000001006 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NPTX2 pAb (ATL-HPA049799) | |
| Datasheet | Anti NPTX2 pAb (ATL-HPA049799) Datasheet (External Link) |
| Vendor Page | Anti NPTX2 pAb (ATL-HPA049799) at Atlas Antibodies |
| Documents & Links for Anti NPTX2 pAb (ATL-HPA049799) | |
| Datasheet | Anti NPTX2 pAb (ATL-HPA049799) Datasheet (External Link) |
| Vendor Page | Anti NPTX2 pAb (ATL-HPA049799) |
| Citations for Anti NPTX2 pAb (ATL-HPA049799) – 1 Found |
| Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |