Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA023295-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: nuclear protein localization 4 homolog (S. cerevisiae)
Gene Name: NPLOC4
Alternative Gene Name: FLJ20657, KIAA1499, NPL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039703: 100%, ENSRNOG00000036698: 100%
Entrez Gene ID: 55666
Uniprot ID: Q8TAT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NPLOC4
Alternative Gene Name: FLJ20657, KIAA1499, NPL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039703: 100%, ENSRNOG00000036698: 100%
Entrez Gene ID: 55666
Uniprot ID: Q8TAT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYL |
Gene Sequence | LEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYL |
Gene ID - Mouse | ENSMUSG00000039703 |
Gene ID - Rat | ENSRNOG00000036698 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation) | |
Datasheet | Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation) | |
Datasheet | Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation) |