Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023295-25
  • Immunohistochemistry analysis in human testis and pancreas tissues using Anti-NPLOC4 antibody. Corresponding NPLOC4 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
  • Western blot analysis using Anti-NPLOC4 antibody HPA023295 (A) shows similar pattern to independent antibody HPA021560 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: nuclear protein localization 4 homolog (S. cerevisiae)
Gene Name: NPLOC4
Alternative Gene Name: FLJ20657, KIAA1499, NPL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039703: 100%, ENSRNOG00000036698: 100%
Entrez Gene ID: 55666
Uniprot ID: Q8TAT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYL
Gene Sequence LEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYL
Gene ID - Mouse ENSMUSG00000039703
Gene ID - Rat ENSRNOG00000036698
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation)
Datasheet Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NPLOC4 pAb (ATL-HPA023295 w/enhanced validation)