Anti NPHP1 pAb (ATL-HPA046093)

Atlas Antibodies

SKU:
ATL-HPA046093-25
  • Immunohistochemical staining of human Fallopian tube shows moderate  cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nephronophthisis 1 (juvenile)
Gene Name: NPHP1
Alternative Gene Name: JBTS4, NPH1, SLSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027378: 59%, ENSRNOG00000015756: 57%
Entrez Gene ID: 4867
Uniprot ID: O15259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVEDTNGSETGFRAWNVQSRGRIFLVSKPVLQINTVDVLTTMGAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPS
Gene Sequence TVEDTNGSETGFRAWNVQSRGRIFLVSKPVLQINTVDVLTTMGAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPS
Gene ID - Mouse ENSMUSG00000027378
Gene ID - Rat ENSRNOG00000015756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NPHP1 pAb (ATL-HPA046093)
Datasheet Anti NPHP1 pAb (ATL-HPA046093) Datasheet (External Link)
Vendor Page Anti NPHP1 pAb (ATL-HPA046093) at Atlas Antibodies

Documents & Links for Anti NPHP1 pAb (ATL-HPA046093)
Datasheet Anti NPHP1 pAb (ATL-HPA046093) Datasheet (External Link)
Vendor Page Anti NPHP1 pAb (ATL-HPA046093)