Anti NPEPPS pAb (ATL-HPA045649)

Atlas Antibodies

SKU:
ATL-HPA045649-25
  • Immunohistochemical staining of human pancreas shows moderate cytoplasmic and nuclear positivity in exocrine glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: aminopeptidase puromycin sensitive
Gene Name: NPEPPS
Alternative Gene Name: MP100, PSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001441: 98%, ENSRNOG00000023095: 98%
Entrez Gene ID: 9520
Uniprot ID: P55786
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEA
Gene Sequence VMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEA
Gene ID - Mouse ENSMUSG00000001441
Gene ID - Rat ENSRNOG00000023095
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NPEPPS pAb (ATL-HPA045649)
Datasheet Anti NPEPPS pAb (ATL-HPA045649) Datasheet (External Link)
Vendor Page Anti NPEPPS pAb (ATL-HPA045649) at Atlas Antibodies

Documents & Links for Anti NPEPPS pAb (ATL-HPA045649)
Datasheet Anti NPEPPS pAb (ATL-HPA045649) Datasheet (External Link)
Vendor Page Anti NPEPPS pAb (ATL-HPA045649)