Anti NPAS3 pAb (ATL-HPA075337)

Atlas Antibodies

SKU:
ATL-HPA075337-25
  • Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line AF22 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: neuronal PAS domain protein 3
Gene Name: NPAS3
Alternative Gene Name: bHLHe12, MOP6, PASD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021010: 96%, ENSRNOG00000024482: 27%
Entrez Gene ID: 64067
Uniprot ID: Q8IXF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDTSGITEDNENSKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGAMQIKVE
Gene Sequence KDTSGITEDNENSKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGAMQIKVE
Gene ID - Mouse ENSMUSG00000021010
Gene ID - Rat ENSRNOG00000024482
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NPAS3 pAb (ATL-HPA075337)
Datasheet Anti NPAS3 pAb (ATL-HPA075337) Datasheet (External Link)
Vendor Page Anti NPAS3 pAb (ATL-HPA075337) at Atlas Antibodies

Documents & Links for Anti NPAS3 pAb (ATL-HPA075337)
Datasheet Anti NPAS3 pAb (ATL-HPA075337) Datasheet (External Link)
Vendor Page Anti NPAS3 pAb (ATL-HPA075337)