Anti NPAS3 pAb (ATL-HPA075337)
Atlas Antibodies
- SKU:
- ATL-HPA075337-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: neuronal PAS domain protein 3
Gene Name: NPAS3
Alternative Gene Name: bHLHe12, MOP6, PASD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021010: 96%, ENSRNOG00000024482: 27%
Entrez Gene ID: 64067
Uniprot ID: Q8IXF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NPAS3
Alternative Gene Name: bHLHe12, MOP6, PASD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021010: 96%, ENSRNOG00000024482: 27%
Entrez Gene ID: 64067
Uniprot ID: Q8IXF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDTSGITEDNENSKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGAMQIKVE |
Gene Sequence | KDTSGITEDNENSKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGAMQIKVE |
Gene ID - Mouse | ENSMUSG00000021010 |
Gene ID - Rat | ENSRNOG00000024482 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NPAS3 pAb (ATL-HPA075337) | |
Datasheet | Anti NPAS3 pAb (ATL-HPA075337) Datasheet (External Link) |
Vendor Page | Anti NPAS3 pAb (ATL-HPA075337) at Atlas Antibodies |
Documents & Links for Anti NPAS3 pAb (ATL-HPA075337) | |
Datasheet | Anti NPAS3 pAb (ATL-HPA075337) Datasheet (External Link) |
Vendor Page | Anti NPAS3 pAb (ATL-HPA075337) |