Anti NOXRED1 pAb (ATL-HPA055658)

Atlas Antibodies

SKU: ATL-HPA055658-25

• 

Protein Description: NADP-dependent oxidoreductase domain containing 1
Gene Name: NOXRED1
Alternative Gene Name: C14orf148, FLJ32809
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072919: 64%, ENSRNOG00000047312: 66%
Entrez Gene ID: 122945
Uniprot ID: Q6NXP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILNIKWLEGVFYAALNICTARNMAHSQVLQLLSELFLSVHFEDCGKDTASCPKLQLTDFVSKAYGKNLSQERPFPWFDLTAVQLKETPFSQHLSSSPVLQDHL
• Gene Sequence: ILNIKWLEGVFYAALNICTARNMAHSQVLQLLSELFLSVHFEDCGKDTASCPKLQLTDFVSKAYGKNLSQERPFPWFDLTAVQLKETPFSQHLSSSPVLQDHL
• Gene ID - Mouse: ENSMUSG00000072919
• Gene ID - Rat: ENSRNOG00000047312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.