Protein Description: notch 1
Gene Name: NOTCH1
Alternative Gene Name: TAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026923: 75%, ENSRNOG00000019322: 75%
Entrez Gene ID: 4851
Uniprot ID: P46531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NOTCH1
Alternative Gene Name: TAN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026923: 75%, ENSRNOG00000019322: 75%
Entrez Gene ID: 4851
Uniprot ID: P46531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL |
| Documents & Links for Anti NOTCH1 pAb (ATL-HPA067168) | |
| Datasheet | Anti NOTCH1 pAb (ATL-HPA067168) Datasheet (External Link) |
| Vendor Page | Anti NOTCH1 pAb (ATL-HPA067168) at Atlas |
| Documents & Links for Anti NOTCH1 pAb (ATL-HPA067168) | |
| Datasheet | Anti NOTCH1 pAb (ATL-HPA067168) Datasheet (External Link) |
| Vendor Page | Anti NOTCH1 pAb (ATL-HPA067168) |