Anti NOS1AP pAb (ATL-HPA055561)

Atlas Antibodies

SKU: ATL-HPA055561-25

• 
• 

Protein Description: nitric oxide synthase 1 (neuronal) adaptor protein
Gene Name: NOS1AP
Alternative Gene Name: CAPON, KIAA0464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038473: 94%, ENSRNOG00000042929: 95%
Entrez Gene ID: 9722
Uniprot ID: O75052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDV
• Gene Sequence: KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDV
• Gene ID - Mouse: ENSMUSG00000038473
• Gene ID - Rat: ENSRNOG00000042929
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.