Anti NOP14 pAb (ATL-HPA055652)

Atlas Antibodies

SKU: ATL-HPA055652-25

• 

Protein Description: NOP14 nucleolar protein
Gene Name: NOP14
Alternative Gene Name: C4orf9, NOL14, RES4-25, UTP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036693: 91%, ENSRNOG00000012147: 90%
Entrez Gene ID: 8602
Uniprot ID: P78316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMER
• Gene Sequence: LQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMER
• Gene ID - Mouse: ENSMUSG00000036693
• Gene ID - Rat: ENSRNOG00000012147
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.