Anti NONO pAb (ATL-HPA054094 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054094-25
  • Immunohistochemical staining of human endometrium, heart muscle, kidney and pancreas using Anti-NONO antibody HPA054094 (A) shows similar protein distribution across tissues to independent antibody HPA054559 (B).
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Western blot analysis in human cell line MOLT-4.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: non-POU domain containing, octamer-binding
Gene Name: NONO
Alternative Gene Name: NMT55, NRB54, P54, P54NRB, PPP1R114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031311: 99%, ENSRNOG00000003689: 97%
Entrez Gene ID: 4841
Uniprot ID: Q15233
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG
Gene Sequence EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG
Gene ID - Mouse ENSMUSG00000031311
Gene ID - Rat ENSRNOG00000003689
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NONO pAb (ATL-HPA054094 w/enhanced validation)
Datasheet Anti NONO pAb (ATL-HPA054094 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NONO pAb (ATL-HPA054094 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NONO pAb (ATL-HPA054094 w/enhanced validation)
Datasheet Anti NONO pAb (ATL-HPA054094 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NONO pAb (ATL-HPA054094 w/enhanced validation)