Anti NOLC1 pAb (ATL-HPA050388)

Atlas Antibodies

SKU: ATL-HPA050388-25

• 
• 

Protein Description: nucleolar and coiled-body phosphoprotein 1
Gene Name: NOLC1
Alternative Gene Name: KIAA0035, NOPP130, NOPP140, P130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015176: 87%, ENSRNOG00000018704: 87%
Entrez Gene ID: 9221
Uniprot ID: Q14978
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF
• Gene Sequence: VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF
• Gene ID - Mouse: ENSMUSG00000015176
• Gene ID - Rat: ENSRNOG00000018704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.