Anti NOL7 pAb (ATL-HPA049693)
Atlas Antibodies
- SKU:
- ATL-HPA049693-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NOL7
Alternative Gene Name: C6orf90, dJ223E5.2, NOP27, PQBP3, RARG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063200: 70%, ENSRNOG00000017904: 72%
Entrez Gene ID: 51406
Uniprot ID: Q9UMY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFL |
Gene Sequence | SPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFL |
Gene ID - Mouse | ENSMUSG00000063200 |
Gene ID - Rat | ENSRNOG00000017904 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NOL7 pAb (ATL-HPA049693) | |
Datasheet | Anti NOL7 pAb (ATL-HPA049693) Datasheet (External Link) |
Vendor Page | Anti NOL7 pAb (ATL-HPA049693) at Atlas Antibodies |
Documents & Links for Anti NOL7 pAb (ATL-HPA049693) | |
Datasheet | Anti NOL7 pAb (ATL-HPA049693) Datasheet (External Link) |
Vendor Page | Anti NOL7 pAb (ATL-HPA049693) |