Anti NODAL pAb (ATL-HPA045201)

Atlas Antibodies

SKU:
ATL-HPA045201-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and NODAL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402640).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nodal growth differentiation factor
Gene Name: NODAL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037171: 64%, ENSRNOG00000000556: 64%
Entrez Gene ID: 4838
Uniprot ID: Q96S42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRV
Gene Sequence PTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRV
Gene ID - Mouse ENSMUSG00000037171
Gene ID - Rat ENSRNOG00000000556
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NODAL pAb (ATL-HPA045201)
Datasheet Anti NODAL pAb (ATL-HPA045201) Datasheet (External Link)
Vendor Page Anti NODAL pAb (ATL-HPA045201) at Atlas Antibodies

Documents & Links for Anti NODAL pAb (ATL-HPA045201)
Datasheet Anti NODAL pAb (ATL-HPA045201) Datasheet (External Link)
Vendor Page Anti NODAL pAb (ATL-HPA045201)