Protein Description: nodal growth differentiation factor
Gene Name: NODAL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037171: 64%, ENSRNOG00000000556: 64%
Entrez Gene ID: 4838
Uniprot ID: Q96S42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NODAL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037171: 64%, ENSRNOG00000000556: 64%
Entrez Gene ID: 4838
Uniprot ID: Q96S42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRV |
| Documents & Links for Anti NODAL pAb (ATL-HPA045201) | |
| Datasheet | Anti NODAL pAb (ATL-HPA045201) Datasheet (External Link) |
| Vendor Page | Anti NODAL pAb (ATL-HPA045201) at Atlas |
| Documents & Links for Anti NODAL pAb (ATL-HPA045201) | |
| Datasheet | Anti NODAL pAb (ATL-HPA045201) Datasheet (External Link) |
| Vendor Page | Anti NODAL pAb (ATL-HPA045201) |