Anti NOCT pAb (ATL-HPA053714)

Atlas Antibodies

SKU:
ATL-HPA053714-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nocturnin
Gene Name: NOCT
Alternative Gene Name: Ccr4c, CCR4L, CCRN4L, NOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023087: 88%, ENSRNOG00000010799: 88%
Entrez Gene ID: 25819
Uniprot ID: Q9UK39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARSCSRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQW
Gene Sequence ARSCSRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQW
Gene ID - Mouse ENSMUSG00000023087
Gene ID - Rat ENSRNOG00000010799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NOCT pAb (ATL-HPA053714)
Datasheet Anti NOCT pAb (ATL-HPA053714) Datasheet (External Link)
Vendor Page Anti NOCT pAb (ATL-HPA053714) at Atlas Antibodies

Documents & Links for Anti NOCT pAb (ATL-HPA053714)
Datasheet Anti NOCT pAb (ATL-HPA053714) Datasheet (External Link)
Vendor Page Anti NOCT pAb (ATL-HPA053714)