Anti NNMT pAb (ATL-HPA059180 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059180-25

• 
• 
• 

Protein Description: nicotinamide N-methyltransferase
Gene Name: NNMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032271: 79%, ENSRNOG00000005930: 79%
Entrez Gene ID: 4837
Uniprot ID: P40261
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP
• Gene Sequence: GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP
• Gene ID - Mouse: ENSMUSG00000032271
• Gene ID - Rat: ENSRNOG00000005930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NNMT pAb (ATL-HPA059180 w/enhanced validation) – 3 Found

Zhang, Li; Song, Mengmeng; Zhang, Fan; Yuan, Hao; Chang, Wenjun; Yu, Guanyu; Niu, Yongdong. Accumulation of Nicotinamide N-Methyltransferase (NNMT) in Cancer-associated Fibroblasts: A Potential Prognostic and Predictive Biomarker for Gastric Carcinoma. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2021;69(3):165-176. 

Song, Mengmeng; Li, Ye; Miao, Mingyong; Zhang, Fan; Yuan, Hao; Cao, Fuao; Chang, Wenjun; Shi, Hanping; Song, Chunhua. High stromal nicotinamide N-methyltransferase (NNMT) indicates poor prognosis in colorectal cancer. Cancer Medicine. 2020;9(6):2030-2038. 

Shen, Hao; Hu, Xuefei; Yang, Xinrui; Chen, Jiahui; Fu, Yating; He, Hongwei; Shi, Yongkang; Zeng, Rong; Chang, Wenjun; Zheng, Shangyong. Inhibition of BRD4 enhanced the tumor suppression effect of dasatinib in gastric cancer. Medical Oncology (Northwood, London, England). 2022;40(1):9.