Protein Description: nicotinamide riboside kinase 2
Gene Name: NMRK2
Alternative Gene Name: ITGB1BP3, MIBP, NRK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004939: 35%, ENSRNOG00000020377: 34%
Entrez Gene ID: 27231
Uniprot ID: Q9NPI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NMRK2
Alternative Gene Name: ITGB1BP3, MIBP, NRK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004939: 35%, ENSRNOG00000020377: 34%
Entrez Gene ID: 27231
Uniprot ID: Q9NPI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM |
| Documents & Links for Anti NMRK2 pAb (ATL-HPA072450) | |
| Datasheet | Anti NMRK2 pAb (ATL-HPA072450) Datasheet (External Link) |
| Vendor Page | Anti NMRK2 pAb (ATL-HPA072450) at Atlas |
| Documents & Links for Anti NMRK2 pAb (ATL-HPA072450) | |
| Datasheet | Anti NMRK2 pAb (ATL-HPA072450) Datasheet (External Link) |
| Vendor Page | Anti NMRK2 pAb (ATL-HPA072450) |