Anti NMRK2 pAb (ATL-HPA072450)

Atlas Antibodies

SKU: ATL-HPA072450-25

• 

Protein Description: nicotinamide riboside kinase 2
Gene Name: NMRK2
Alternative Gene Name: ITGB1BP3, MIBP, NRK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004939: 35%, ENSRNOG00000020377: 34%
Entrez Gene ID: 27231
Uniprot ID: Q9NPI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM
• Gene Sequence: VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM
• Gene ID - Mouse: ENSMUSG00000004939
• Gene ID - Rat: ENSRNOG00000020377
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.