Anti NMRK1 pAb (ATL-HPA049795)

Atlas Antibodies

SKU:
ATL-HPA049795-25
  • Immunohistochemical staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nicotinamide riboside kinase 1
Gene Name: NMRK1
Alternative Gene Name: bA235O14.2, C9orf95, FLJ20559, NRK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037847: 79%, ENSRNOG00000012665: 79%
Entrez Gene ID: 54981
Uniprot ID: Q9NWW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRS
Gene Sequence DDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRS
Gene ID - Mouse ENSMUSG00000037847
Gene ID - Rat ENSRNOG00000012665
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NMRK1 pAb (ATL-HPA049795)
Datasheet Anti NMRK1 pAb (ATL-HPA049795) Datasheet (External Link)
Vendor Page Anti NMRK1 pAb (ATL-HPA049795) at Atlas Antibodies

Documents & Links for Anti NMRK1 pAb (ATL-HPA049795)
Datasheet Anti NMRK1 pAb (ATL-HPA049795) Datasheet (External Link)
Vendor Page Anti NMRK1 pAb (ATL-HPA049795)