Anti NLRP13 pAb (ATL-HPA060459)

Atlas Antibodies

SKU:
ATL-HPA060459-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic, membranous and nucleolar or nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NLR family, pyrin domain containing 13
Gene Name: NLRP13
Alternative Gene Name: CLR19.7, NALP13, NOD14, PAN13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034690: 25%, ENSRNOG00000008134: 28%
Entrez Gene ID: 126204
Uniprot ID: Q86W25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLPYLMALDQYQLEEFKLCLEPQQLMDFWSAPQGHFPRIPWANLRAADPLNLSFLLDEHFPKGQAWKVVLGIFQTMNLTSLCEKVRAEMKENVQTQELQDPTQED
Gene Sequence LLPYLMALDQYQLEEFKLCLEPQQLMDFWSAPQGHFPRIPWANLRAADPLNLSFLLDEHFPKGQAWKVVLGIFQTMNLTSLCEKVRAEMKENVQTQELQDPTQED
Gene ID - Mouse ENSMUSG00000034690
Gene ID - Rat ENSRNOG00000008134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NLRP13 pAb (ATL-HPA060459)
Datasheet Anti NLRP13 pAb (ATL-HPA060459) Datasheet (External Link)
Vendor Page Anti NLRP13 pAb (ATL-HPA060459) at Atlas Antibodies

Documents & Links for Anti NLRP13 pAb (ATL-HPA060459)
Datasheet Anti NLRP13 pAb (ATL-HPA060459) Datasheet (External Link)
Vendor Page Anti NLRP13 pAb (ATL-HPA060459)