Protein Description: NLR family pyrin domain containing 11
Gene Name: NLRP11
Alternative Gene Name: CLR19.6, NALP11, NOD17, PAN10, PYPAF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038650: 36%, ENSRNOG00000016416: 35%
Entrez Gene ID: 204801
Uniprot ID: P59045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NLRP11
Alternative Gene Name: CLR19.6, NALP11, NOD17, PAN10, PYPAF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038650: 36%, ENSRNOG00000016416: 35%
Entrez Gene ID: 204801
Uniprot ID: P59045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQISHLSLMKCDLRASE |
| Documents & Links for Anti NLRP11 pAb (ATL-HPA078027) | |
| Datasheet | Anti NLRP11 pAb (ATL-HPA078027) Datasheet (External Link) |
| Vendor Page | Anti NLRP11 pAb (ATL-HPA078027) at Atlas |
| Documents & Links for Anti NLRP11 pAb (ATL-HPA078027) | |
| Datasheet | Anti NLRP11 pAb (ATL-HPA078027) Datasheet (External Link) |
| Vendor Page | Anti NLRP11 pAb (ATL-HPA078027) |