Anti NLRP11 pAb (ATL-HPA078027)

Atlas Antibodies

SKU:
ATL-HPA078027-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NLR family pyrin domain containing 11
Gene Name: NLRP11
Alternative Gene Name: CLR19.6, NALP11, NOD17, PAN10, PYPAF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038650: 36%, ENSRNOG00000016416: 35%
Entrez Gene ID: 204801
Uniprot ID: P59045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQISHLSLMKCDLRASE
Gene Sequence LRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQISHLSLMKCDLRASE
Gene ID - Mouse ENSMUSG00000038650
Gene ID - Rat ENSRNOG00000016416
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NLRP11 pAb (ATL-HPA078027)
Datasheet Anti NLRP11 pAb (ATL-HPA078027) Datasheet (External Link)
Vendor Page Anti NLRP11 pAb (ATL-HPA078027) at Atlas Antibodies

Documents & Links for Anti NLRP11 pAb (ATL-HPA078027)
Datasheet Anti NLRP11 pAb (ATL-HPA078027) Datasheet (External Link)
Vendor Page Anti NLRP11 pAb (ATL-HPA078027)