Anti NLK pAb (ATL-HPA056511)

Atlas Antibodies

SKU: ATL-HPA056511-25

• 
• 

Product Description

Protein Description: nemo-like kinase
Gene Name: NLK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017376: 100%, ENSRNOG00000008704: 100%
Entrez Gene ID: 51701
Uniprot ID: Q9UBE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAATVKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
• Gene Sequence: AAATVKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
• Gene ID - Mouse: ENSMUSG00000017376
• Gene ID - Rat: ENSRNOG00000008704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links