Anti NKD2 pAb (ATL-HPA049463)
Atlas Antibodies
- SKU:
- ATL-HPA049463-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NKD2
Alternative Gene Name: Naked2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021567: 75%, ENSRNOG00000016103: 77%
Entrez Gene ID: 85409
Uniprot ID: Q969F2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHE |
Gene Sequence | GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHE |
Gene ID - Mouse | ENSMUSG00000021567 |
Gene ID - Rat | ENSRNOG00000016103 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NKD2 pAb (ATL-HPA049463) | |
Datasheet | Anti NKD2 pAb (ATL-HPA049463) Datasheet (External Link) |
Vendor Page | Anti NKD2 pAb (ATL-HPA049463) at Atlas Antibodies |
Documents & Links for Anti NKD2 pAb (ATL-HPA049463) | |
Datasheet | Anti NKD2 pAb (ATL-HPA049463) Datasheet (External Link) |
Vendor Page | Anti NKD2 pAb (ATL-HPA049463) |