Anti NIPAL2 pAb (ATL-HPA071759)
Atlas Antibodies
- SKU:
- ATL-HPA071759-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NIPAL2
Alternative Gene Name: FLJ13955, NPAL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038879: 53%, ENSRNOG00000005190: 56%
Entrez Gene ID: 79815
Uniprot ID: Q9H841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETN |
Gene Sequence | FLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETN |
Gene ID - Mouse | ENSMUSG00000038879 |
Gene ID - Rat | ENSRNOG00000005190 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NIPAL2 pAb (ATL-HPA071759) | |
Datasheet | Anti NIPAL2 pAb (ATL-HPA071759) Datasheet (External Link) |
Vendor Page | Anti NIPAL2 pAb (ATL-HPA071759) at Atlas Antibodies |
Documents & Links for Anti NIPAL2 pAb (ATL-HPA071759) | |
Datasheet | Anti NIPAL2 pAb (ATL-HPA071759) Datasheet (External Link) |
Vendor Page | Anti NIPAL2 pAb (ATL-HPA071759) |