Protein Description: NIPA-like domain containing 2
Gene Name: NIPAL2
Alternative Gene Name: FLJ13955, NPAL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038879: 53%, ENSRNOG00000005190: 56%
Entrez Gene ID: 79815
Uniprot ID: Q9H841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NIPAL2
Alternative Gene Name: FLJ13955, NPAL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038879: 53%, ENSRNOG00000005190: 56%
Entrez Gene ID: 79815
Uniprot ID: Q9H841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETN |
| Documents & Links for Anti NIPAL2 pAb (ATL-HPA071759) | |
| Datasheet | Anti NIPAL2 pAb (ATL-HPA071759) Datasheet (External Link) |
| Vendor Page | Anti NIPAL2 pAb (ATL-HPA071759) at Atlas |
| Documents & Links for Anti NIPAL2 pAb (ATL-HPA071759) | |
| Datasheet | Anti NIPAL2 pAb (ATL-HPA071759) Datasheet (External Link) |
| Vendor Page | Anti NIPAL2 pAb (ATL-HPA071759) |