Anti NIPAL2 pAb (ATL-HPA071759)

Atlas Antibodies

SKU:
ATL-HPA071759-25
  • Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NIPA-like domain containing 2
Gene Name: NIPAL2
Alternative Gene Name: FLJ13955, NPAL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038879: 53%, ENSRNOG00000005190: 56%
Entrez Gene ID: 79815
Uniprot ID: Q9H841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETN
Gene Sequence FLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETN
Gene ID - Mouse ENSMUSG00000038879
Gene ID - Rat ENSRNOG00000005190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NIPAL2 pAb (ATL-HPA071759)
Datasheet Anti NIPAL2 pAb (ATL-HPA071759) Datasheet (External Link)
Vendor Page Anti NIPAL2 pAb (ATL-HPA071759) at Atlas Antibodies

Documents & Links for Anti NIPAL2 pAb (ATL-HPA071759)
Datasheet Anti NIPAL2 pAb (ATL-HPA071759) Datasheet (External Link)
Vendor Page Anti NIPAL2 pAb (ATL-HPA071759)