Anti NINL pAb (ATL-HPA000686)

Atlas Antibodies

Catalog No.:
ATL-HPA000686-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ninein-like
Gene Name: NINL
Alternative Gene Name: KIAA0980, NLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068115: 47%, ENSRNOG00000027747: 49%
Entrez Gene ID: 22981
Uniprot ID: Q9Y2I6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL
Gene Sequence LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL
Gene ID - Mouse ENSMUSG00000068115
Gene ID - Rat ENSRNOG00000027747
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NINL pAb (ATL-HPA000686)
Datasheet Anti NINL pAb (ATL-HPA000686) Datasheet (External Link)
Vendor Page Anti NINL pAb (ATL-HPA000686) at Atlas Antibodies

Documents & Links for Anti NINL pAb (ATL-HPA000686)
Datasheet Anti NINL pAb (ATL-HPA000686) Datasheet (External Link)
Vendor Page Anti NINL pAb (ATL-HPA000686)
Citations for Anti NINL pAb (ATL-HPA000686) – 1 Found
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed