Anti NINL pAb (ATL-HPA000686)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000686-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NINL
Alternative Gene Name: KIAA0980, NLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068115: 47%, ENSRNOG00000027747: 49%
Entrez Gene ID: 22981
Uniprot ID: Q9Y2I6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL |
Gene Sequence | LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL |
Gene ID - Mouse | ENSMUSG00000068115 |
Gene ID - Rat | ENSRNOG00000027747 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NINL pAb (ATL-HPA000686) | |
Datasheet | Anti NINL pAb (ATL-HPA000686) Datasheet (External Link) |
Vendor Page | Anti NINL pAb (ATL-HPA000686) at Atlas Antibodies |
Documents & Links for Anti NINL pAb (ATL-HPA000686) | |
Datasheet | Anti NINL pAb (ATL-HPA000686) Datasheet (External Link) |
Vendor Page | Anti NINL pAb (ATL-HPA000686) |
Citations for Anti NINL pAb (ATL-HPA000686) – 1 Found |
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |