Anti NHP2 pAb (ATL-HPA050400 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050400-25

• 
• 

Protein Description: NHP2 ribonucleoprotein
Gene Name: NHP2
Alternative Gene Name: FLJ20479, NOLA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001056: 88%, ENSRNOG00000049622: 88%
Entrez Gene ID: 55651
Uniprot ID: Q9NX24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGE
• Gene Sequence: IKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGE
• Gene ID - Mouse: ENSMUSG00000001056
• Gene ID - Rat: ENSRNOG00000049622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.