Anti NHLRC2 pAb (ATL-HPA057564)
Atlas Antibodies
- SKU:
- ATL-HPA057564-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NHLRC2
Alternative Gene Name: DKFZp779F115, FLJ20147, FLJ25621, FLJ33312, MGC45492
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025078: 83%, ENSRNOG00000016948: 85%
Entrez Gene ID: 374354
Uniprot ID: Q8NBF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPIS |
Gene Sequence | TGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPIS |
Gene ID - Mouse | ENSMUSG00000025078 |
Gene ID - Rat | ENSRNOG00000016948 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NHLRC2 pAb (ATL-HPA057564) | |
Datasheet | Anti NHLRC2 pAb (ATL-HPA057564) Datasheet (External Link) |
Vendor Page | Anti NHLRC2 pAb (ATL-HPA057564) at Atlas Antibodies |
Documents & Links for Anti NHLRC2 pAb (ATL-HPA057564) | |
Datasheet | Anti NHLRC2 pAb (ATL-HPA057564) Datasheet (External Link) |
Vendor Page | Anti NHLRC2 pAb (ATL-HPA057564) |