Anti NHLRC2 pAb (ATL-HPA057564)

Atlas Antibodies

SKU:
ATL-HPA057564-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NHL repeat containing 2
Gene Name: NHLRC2
Alternative Gene Name: DKFZp779F115, FLJ20147, FLJ25621, FLJ33312, MGC45492
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025078: 83%, ENSRNOG00000016948: 85%
Entrez Gene ID: 374354
Uniprot ID: Q8NBF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPIS
Gene Sequence TGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPIS
Gene ID - Mouse ENSMUSG00000025078
Gene ID - Rat ENSRNOG00000016948
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NHLRC2 pAb (ATL-HPA057564)
Datasheet Anti NHLRC2 pAb (ATL-HPA057564) Datasheet (External Link)
Vendor Page Anti NHLRC2 pAb (ATL-HPA057564) at Atlas Antibodies

Documents & Links for Anti NHLRC2 pAb (ATL-HPA057564)
Datasheet Anti NHLRC2 pAb (ATL-HPA057564) Datasheet (External Link)
Vendor Page Anti NHLRC2 pAb (ATL-HPA057564)