Anti NHLH2 pAb (ATL-HPA055238)

Atlas Antibodies

SKU: ATL-HPA055238-25

• 
• 

Protein Description: nescient helix loop helix 2
Gene Name: NHLH2
Alternative Gene Name: bHLHa34, HEN2, NSCL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048540: 95%, ENSRNOG00000054375: 94%
Entrez Gene ID: 4808
Uniprot ID: Q02577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREE
• Gene Sequence: LSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREE
• Gene ID - Mouse: ENSMUSG00000048540
• Gene ID - Rat: ENSRNOG00000054375
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NHLH2 pAb (ATL-HPA055238) – 1 Found

Pebworth, Mark-Phillip; Ross, Jayden; Andrews, Madeline; Bhaduri, Aparna; Kriegstein, Arnold R. Human intermediate progenitor diversity during cortical development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(26)