Anti NGB pAb (ATL-HPA058596 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058596-25
  • Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-NGB antibody. Corresponding NGB RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: neuroglobin
Gene Name: NGB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021032: 93%, ENSRNOG00000011719: 95%
Entrez Gene ID: 58157
Uniprot ID: Q9NPG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Gene Sequence ESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Gene ID - Mouse ENSMUSG00000021032
Gene ID - Rat ENSRNOG00000011719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NGB pAb (ATL-HPA058596 w/enhanced validation)
Datasheet Anti NGB pAb (ATL-HPA058596 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NGB pAb (ATL-HPA058596 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NGB pAb (ATL-HPA058596 w/enhanced validation)
Datasheet Anti NGB pAb (ATL-HPA058596 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NGB pAb (ATL-HPA058596 w/enhanced validation)