Anti NFYC pAb (ATL-HPA055011)

Atlas Antibodies

SKU:
ATL-HPA055011-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nuclear transcription factor Y, gamma
Gene Name: NFYC
Alternative Gene Name: CBF-C, NF-YC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032897: 99%, ENSRNOG00000010735: 100%
Entrez Gene ID: 4802
Uniprot ID: Q13952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQ
Gene Sequence EPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQ
Gene ID - Mouse ENSMUSG00000032897
Gene ID - Rat ENSRNOG00000010735
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NFYC pAb (ATL-HPA055011)
Datasheet Anti NFYC pAb (ATL-HPA055011) Datasheet (External Link)
Vendor Page Anti NFYC pAb (ATL-HPA055011) at Atlas Antibodies

Documents & Links for Anti NFYC pAb (ATL-HPA055011)
Datasheet Anti NFYC pAb (ATL-HPA055011) Datasheet (External Link)
Vendor Page Anti NFYC pAb (ATL-HPA055011)