Anti NFX1 pAb (ATL-HPA061382)
Atlas Antibodies
- SKU:
- ATL-HPA061382-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: nuclear transcription factor, X-box binding 1
Gene Name: NFX1
Alternative Gene Name: MGC20369, NFX2, TEG-42, Tex42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028423: 73%, ENSRNOG00000009015: 73%
Entrez Gene ID: 4799
Uniprot ID: Q12986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NFX1
Alternative Gene Name: MGC20369, NFX2, TEG-42, Tex42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028423: 73%, ENSRNOG00000009015: 73%
Entrez Gene ID: 4799
Uniprot ID: Q12986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VFHPDSSEASSRKGVLDGYGARRNEQRRYPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENLAVINKSSR |
Gene Sequence | VFHPDSSEASSRKGVLDGYGARRNEQRRYPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENLAVINKSSR |
Gene ID - Mouse | ENSMUSG00000028423 |
Gene ID - Rat | ENSRNOG00000009015 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NFX1 pAb (ATL-HPA061382) | |
Datasheet | Anti NFX1 pAb (ATL-HPA061382) Datasheet (External Link) |
Vendor Page | Anti NFX1 pAb (ATL-HPA061382) at Atlas Antibodies |
Documents & Links for Anti NFX1 pAb (ATL-HPA061382) | |
Datasheet | Anti NFX1 pAb (ATL-HPA061382) Datasheet (External Link) |
Vendor Page | Anti NFX1 pAb (ATL-HPA061382) |