Anti NFX1 pAb (ATL-HPA061382)

Atlas Antibodies

SKU:
ATL-HPA061382-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: nuclear transcription factor, X-box binding 1
Gene Name: NFX1
Alternative Gene Name: MGC20369, NFX2, TEG-42, Tex42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028423: 73%, ENSRNOG00000009015: 73%
Entrez Gene ID: 4799
Uniprot ID: Q12986
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFHPDSSEASSRKGVLDGYGARRNEQRRYPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENLAVINKSSR
Gene Sequence VFHPDSSEASSRKGVLDGYGARRNEQRRYPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENLAVINKSSR
Gene ID - Mouse ENSMUSG00000028423
Gene ID - Rat ENSRNOG00000009015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NFX1 pAb (ATL-HPA061382)
Datasheet Anti NFX1 pAb (ATL-HPA061382) Datasheet (External Link)
Vendor Page Anti NFX1 pAb (ATL-HPA061382) at Atlas Antibodies

Documents & Links for Anti NFX1 pAb (ATL-HPA061382)
Datasheet Anti NFX1 pAb (ATL-HPA061382) Datasheet (External Link)
Vendor Page Anti NFX1 pAb (ATL-HPA061382)