Anti NFS1 pAb (ATL-HPA051801 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051801-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-NFS1 antibody HPA051801 (A) shows similar protein distribution across tissues to independent antibody HPA054755 (B).
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NFS1 cysteine desulfurase
Gene Name: NFS1
Alternative Gene Name: IscS, NifS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027618: 95%, ENSRNOG00000045686: 95%
Entrez Gene ID: 9054
Uniprot ID: Q9Y697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF
Gene Sequence GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF
Gene ID - Mouse ENSMUSG00000027618
Gene ID - Rat ENSRNOG00000045686
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NFS1 pAb (ATL-HPA051801 w/enhanced validation)
Datasheet Anti NFS1 pAb (ATL-HPA051801 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NFS1 pAb (ATL-HPA051801 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NFS1 pAb (ATL-HPA051801 w/enhanced validation)
Datasheet Anti NFS1 pAb (ATL-HPA051801 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NFS1 pAb (ATL-HPA051801 w/enhanced validation)