Anti NFKBID pAb (ATL-HPA054778)

Atlas Antibodies

Catalog No.:
ATL-HPA054778-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NFKB inhibitor delta
Gene Name: NFKBID
Alternative Gene Name: IkappaBNS, TA-NFKBH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036931: 84%, ENSRNOG00000025111: 86%
Entrez Gene ID: 84807
Uniprot ID: Q8NI38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALH
Gene Sequence PSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALH
Gene ID - Mouse ENSMUSG00000036931
Gene ID - Rat ENSRNOG00000025111
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NFKBID pAb (ATL-HPA054778)
Datasheet Anti NFKBID pAb (ATL-HPA054778) Datasheet (External Link)
Vendor Page Anti NFKBID pAb (ATL-HPA054778) at Atlas Antibodies

Documents & Links for Anti NFKBID pAb (ATL-HPA054778)
Datasheet Anti NFKBID pAb (ATL-HPA054778) Datasheet (External Link)
Vendor Page Anti NFKBID pAb (ATL-HPA054778)