Anti NFIC pAb (ATL-HPA052625)

Atlas Antibodies

SKU: ATL-HPA052625-25

• 
• 

Protein Description: nuclear factor I/C (CCAAT-binding transcription factor)
Gene Name: NFIC
Alternative Gene Name: CTF, CTF5, NF-I, NFI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055053: 97%, ENSRNOG00000004505: 99%
Entrez Gene ID: 4782
Uniprot ID: P08651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS
• Gene Sequence: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS
• Gene ID - Mouse: ENSMUSG00000055053
• Gene ID - Rat: ENSRNOG00000004505
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.