Protein Description: nuclear factor, erythroid 2-like 1
Gene Name: NFE2L1
Alternative Gene Name: FLJ00380, LCR-F1, NRF1, TCF11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038615: 99%, ENSRNOG00000001548: 51%
Entrez Gene ID: 4779
Uniprot ID: Q14494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NFE2L1
Alternative Gene Name: FLJ00380, LCR-F1, NRF1, TCF11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038615: 99%, ENSRNOG00000001548: 51%
Entrez Gene ID: 4779
Uniprot ID: Q14494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP |
Documents & Links for Anti NFE2L1 pAb (ATL-HPA065424) | |
Datasheet | Anti NFE2L1 pAb (ATL-HPA065424) Datasheet (External Link) |
Vendor Page | Anti NFE2L1 pAb (ATL-HPA065424) at Atlas |
Documents & Links for Anti NFE2L1 pAb (ATL-HPA065424) | |
Datasheet | Anti NFE2L1 pAb (ATL-HPA065424) Datasheet (External Link) |
Vendor Page | Anti NFE2L1 pAb (ATL-HPA065424) |