Anti NFE2L1 pAb (ATL-HPA065424)

Atlas Antibodies

SKU: ATL-HPA065424-25

• 

Protein Description: nuclear factor, erythroid 2-like 1
Gene Name: NFE2L1
Alternative Gene Name: FLJ00380, LCR-F1, NRF1, TCF11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038615: 99%, ENSRNOG00000001548: 51%
Entrez Gene ID: 4779
Uniprot ID: Q14494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
• Gene Sequence: LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
• Gene ID - Mouse: ENSMUSG00000038615
• Gene ID - Rat: ENSRNOG00000001548
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.