Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001914-25

• 
• 

Protein Description: nuclear factor, erythroid 2
Gene Name: NFE2
Alternative Gene Name: NF-E2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058794: 82%, ENSRNOG00000036837: 85%
Entrez Gene ID: 4778
Uniprot ID: Q16621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES
• Gene Sequence: SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES
• Gene ID - Mouse: ENSMUSG00000058794
• Gene ID - Rat: ENSRNOG00000036837
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) – 2 Found

Lahon, Anismrita; Arya, Ravi P; Banerjea, Akhil C. Dengue Virus Dysregulates Master Transcription Factors and PI3K/AKT/mTOR Signaling Pathway in Megakaryocytes. Frontiers In Cellular And Infection Microbiology. 11( 34513730):715208. 

Aumann, Konrad; Frey, Anna-Verena; May, Annette M; Hauschke, Dieter; Kreutz, Clemens; Marx, Jan P; Timmer, Jens; Werner, Martin; Pahl, Heike L. Subcellular mislocalization of the transcription factor NF-E2 in erythroid cells discriminates prefibrotic primary myelofibrosis from essential thrombocythemia. Blood. 2013;122(1):93-9.