Anti NELL1 pAb (ATL-HPA051535)

Atlas Antibodies

SKU: ATL-HPA051535-25

• 

Protein Description: NEL-like 1 (chicken)
Gene Name: NELL1
Alternative Gene Name: FLJ45906, IDH3GL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055409: 96%, ENSRNOG00000015675: 95%
Entrez Gene ID: 4745
Uniprot ID: Q92832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECK
• Gene Sequence: CHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECK
• Gene ID - Mouse: ENSMUSG00000055409
• Gene ID - Rat: ENSRNOG00000015675
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NELL1 pAb (ATL-HPA051535) – 2 Found

Kudose, Satoru; Sekulic, Miroslav; Mehring, Collette J; Santoriello, Dominick; Batal, Ibrahim; Stokes, M Barry; D'Agati, Vivette D; Markowitz, Glen S. NELL1-Associated Membranous Glomerulopathy After Hematopoietic Stem Cell Transplantation. Kidney International Reports. 2021;6(7):1992-1995. 

Nakamura, Ritsuko; Oyama, Takeru; Tajiri, Ryosuke; Mizokami, Atsushi; Namiki, Mikio; Nakamoto, Masaru; Ooi, Akishi. Expression and regulatory effects on cancer cell behavior of NELL1 and NELL2 in human renal cell carcinoma. Cancer Science. 2015;106(5):656-64.