Protein Description: neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
Gene Name: NEDD4L
Alternative Gene Name: KIAA0439, NEDD4-2, RSP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024589: 97%, ENSRNOG00000017610: 97%
Entrez Gene ID: 23327
Uniprot ID: Q96PU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEDD4L
Alternative Gene Name: KIAA0439, NEDD4-2, RSP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024589: 97%, ENSRNOG00000017610: 97%
Entrez Gene ID: 23327
Uniprot ID: Q96PU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP |
Documents & Links for Anti NEDD4L pAb (ATL-HPA064730) | |
Datasheet | Anti NEDD4L pAb (ATL-HPA064730) Datasheet (External Link) |
Vendor Page | Anti NEDD4L pAb (ATL-HPA064730) at Atlas |
Documents & Links for Anti NEDD4L pAb (ATL-HPA064730) | |
Datasheet | Anti NEDD4L pAb (ATL-HPA064730) Datasheet (External Link) |
Vendor Page | Anti NEDD4L pAb (ATL-HPA064730) |